Category
Antibody
Concentration
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Form
Antigen affinity purified
Antibody
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Antigen affinity purified
Unconjugated
Polyclonal antibody
Myosin Phosphatase / PPP1R12A
Rabbit (Oryctolagus cuniculus)
Polyclonal (rabbit origin)
Human (Homo sapiens), Mouse (Mus musculus) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
WB, IHC-P
Western blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
Optimal dilution of the PPP1R12A antibody should be determined by the researcher.
This PPP1R12A antibodyis to be used only for research purposes and not for diagnostics..
O14974
Antigen affinity
PPP1R12A (Protein phosphatase 1 regulatory subunit 12A), also called MYPT1 (Myosin phosphatase target subunit 1), is an enzyme that in humans is encoded by the PPP1R12A gene. PPP1R12A is one of the subunits of myosin phosphatase. Sequencing analysis showed that human PPP1R12A contains 1,030 amino acids with a calculated molecular mass of approximately 115 kD. The PPP1R12A gene is mapped on 12q21.2-q21.3. PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation. The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function characterized by merlin phosphorylation, Ras activation, and transformation. Jin et al. concluded that PPP1R12A and its substrate merlin are part of a previously undescribed tumor suppressor cascade that can be hindered in two ways, by mutation of the NF2 gene and by upregulation of the oncoprotein CPI17.
Amino acids MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD of human PPP1R12A were used as the immunogen for the PPP1R12A antibody.
After reconstitution, the PPP1R12A antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
Cytoplasmic
If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
anticorps
