Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)

Description

Recombinant Human Inosine Triphosphate Pyrophosphatase is produced by our E.coli expression system and the target gene encoding Ala2-Ala194 is expressed with a 6His tag at the C-terminus.

Species reactivity

Human

Origin

Escherichia coli

Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)

Peptide sequence

MAASLVGKKIVFVTGNAKKLEEVVQILGDKFPCTLVAQKIDLPEYQGEPDEISIQKCQEAVRQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVRLFRGRTSGRIVAPRGCQDFGWDPCFQPDGYEQTYAEMPKAEKNAVSHRFRALLELQEYFGSLAALEHHHHHH

Estimated molecular weight

22,5 kDa

Protein purity

Greater than 95% as determined by reducing SDS-PAGE.

Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)

Endotoxin level

Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

Shipping condition

Dry Ice/ice packs

Package form

Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, pH 8.0.

Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)

Storage conditions

Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Reconstitution conditions

Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

UniProt number

Q9BY32

Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)

Properties

Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.

Source

Recombinants or rec. proteins

Group

recombinants

Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)
Recombinant Human Inosine Triphosphate Pyrophosphatase/ITPase (C-6His)