Description
Recombinant Human FBPase 1 is produced by our Mammalian expression system and the target gene encoding Ala2-Gln338 is expressed with a 6His tag at the C-terminus.
Species reactivity
Human
Origin
Human Cells
1 mg
CD77-1000
2283€
Recombinant Human FBPase 1 is produced by our Mammalian expression system and the target gene encoding Ala2-Gln338 is expressed with a 6His tag at the C-terminus.
Human
Human Cells
ADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQVDHHHHHH
37,8 kDa
Greater than 95% as determined by reducing SDS-PAGE.
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Dry ice/ice packs
Supplied as a 0.2 µm filtered solution of 20mM TrisHCl,200mM NaCl,1mM DTT,10% Glycerol,pH 8.0.
Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
P09467
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Recombinants or rec. proteins
recombinants
