Target antigen
PTPN22
Clonality
Polyclonal antibody
Clone
Polyclonal antibody
PTPN22
Polyclonal antibody
Polyclonal antibody
rabbit
IgG polyclonal antibody
freeze-dried
human, rat
WB
A synthetic peptide corresponding to a sequence at the N-terminus of human PTPN22 (1-42aa MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADK), different from the related mouse sequence by eight amino acids.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Immunogen affinity purified.
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
Keep the PTPN22 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
The PTPN22 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
Protein tyrosine phosphatase, non-receptor type 22 (lymphoid), also known as PTPN22, is a protein that in humans is encoded by the PTPN22 gene. This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described.
1. Cohen S, Dadi H, Shaoul E, Sharfe N, Roifman CM (March 1999). "Cloning and characterization of a lymphoid-specific, inducible human protein tyrosine phosphatase, Lyp". Blood 93 (6): 2013–24. 2. Cloutier JF, Veillette A (September 1996)."Association of inhibitory tyrosine protein kinase p50csk with protein tyrosine phosphatase PEP in T cells and other hemopoietic cells". EMBO J. 15(18): 4909–18. 3. Matthews RJ, Bowne DB, Flores E, Thomas ML (May 1992). "Characterization of hematopoietic intracellular protein tyrosine phosphatases: description of a phosphatase containing an SH2 domain and another enriched in proline-, glutamic acid-, serine-, and threonine-rich sequences".Mol. Cell. Biol. 12 (5): 2396–405.
PTPN22
Tyrosine-protein phosphatase non-receptor type 22
protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Hematopoietic cell protein tyrosine phosphatase 70Z PEP antibody|Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP antibody| Lymphoid phosphatase antibody|Lymphoid specific protein tyrosine phosphatase antibody|lymphoid-specific, inducible human protein tyrosine phosphatase antibody|Lyp 1 antibody|Lyp 2 antibody|LyP antibody|Lyp1 antibody|Lyp2 antibody|LyPTP antibody| OTTHUMP00000013720 antibody|OTTHUMP00000013721 antibody|OTTHUMP00000233450 antibody|OTTHUMP00000233451 antibody|PEP antibody|PEST-domain phosphatase antibody|Protein tyrosine phosphatase non receptor type 22 (lymphoid) antibody|Protein tyrosine phosphatase non receptor type 22 antibody|Protein tyrosine phosphatase non receptor type 8 antibody|Protein tyrosine phosphatase non receptor type 8, formerly antibody|PTN22_HUMAN antibody|PTPN 22 antibody|PTPN 8 antibody|Ptpn22 antibody|PTPN8 antibody|PTPN8, formerly antibody| Tyrosine-protein phosphatase non-receptor type 22 antibody
Q9Y2R2
26191
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
anticorps
