Polyclonal
30ug for $99, contact us for details
A synthetic peptide corresponding to a sequence at the N-terminus of human PTPN22 (1-42aa MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADK), different from the related mouse sequence by eight amino acids.
Lyophilized
Immunogen affinity purified.
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
No cross reactivity with other proteins.
N/A
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Western blot, 0.1-0.5µg/ml, Human, RatImmunohistochemistry(Frozen Section), 0.5-1µg/ml, Human Immunocytochemistry, 0.5-1µg/ml, Human Flow Cytometry, 1-3µg/1x106 cells, Human, Mouse
Flow Cytometry, IHC, ICC, WB
Human, Mouse, Rat
www.bosterbio.com/datasheet.php?sku=PB9784
This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
anticorps
